99
|
ATCC
february 2009 b c f o d f o p m w e k February 2009 B C F O D F O P M W E K, supplied by ATCC, used in various techniques. Bioz Stars score: 99/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/february 2009 b c f o d f o p m w e k/product/ATCC Average 99 stars, based on 1 article reviews
february 2009 b c f o d f o p m w e k - by Bioz Stars,
2026-06
99/100 stars
|
Buy from Supplier |
90
|
PhenoPath
r package phenopath v1.4.0 R Package Phenopath V1.4.0, supplied by PhenoPath, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/r package phenopath v1.4.0/product/PhenoPath Average 90 stars, based on 1 article reviews
r package phenopath v1.4.0 - by Bioz Stars,
2026-06
90/100 stars
|
Buy from Supplier |
90
|
Siemens AG
primer pair f actin /r actin Primer Pair F Actin /R Actin, supplied by Siemens AG, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/primer pair f actin /r actin/product/Siemens AG Average 90 stars, based on 1 article reviews
primer pair f actin /r actin - by Bioz Stars,
2026-06
90/100 stars
|
Buy from Supplier |
90
|
GraphPad Software Inc
prism 6.02 Prism 6.02, supplied by GraphPad Software Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/prism 6.02/product/GraphPad Software Inc Average 90 stars, based on 1 article reviews
prism 6.02 - by Bioz Stars,
2026-06
90/100 stars
|
Buy from Supplier |
90
|
Calmet Laboratory Services
r. rattus R. Rattus, supplied by Calmet Laboratory Services, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/r. rattus/product/Calmet Laboratory Services Average 90 stars, based on 1 article reviews
r. rattus - by Bioz Stars,
2026-06
90/100 stars
|
Buy from Supplier |
N/A
|
EphA8 antibody was raised in Mouse using a purified recombinant fragment of EphA8(aa70-150) expressed in E. coli as the immunogen. Mouse monoclonal EphA8 antibody.
|
Buy from Supplier |
N/A
|
Rabbit polyclonal Transaldolase antibody (HRP)
|
Buy from Supplier |
N/A
|
GUK1 antibody was raised using the middle region of GUK1 corresponding to a region with amino acids IEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYI. Rabbit polyclonal GUK1 antibody raised against the middle region of GUK1.
|
Buy from Supplier |
N/A
|
The IgG2b Antibody (RM108) [Biotin] from Novus is a IgG2b antibody to IgG2b. This antibody reacts with Mouse. The IgG2b antibody has been validated for the following applications: Western Blot, ELISA.
|
Buy from Supplier |