r 2009 b Search Results


99
ATCC february 2009 b c f o d f o p m w e k
February 2009 B C F O D F O P M W E K, supplied by ATCC, used in various techniques. Bioz Stars score: 99/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/february 2009 b c f o d f o p m w e k/product/ATCC
Average 99 stars, based on 1 article reviews
february 2009 b c f o d f o p m w e k - by Bioz Stars, 2026-06
99/100 stars
  Buy from Supplier

90
PhenoPath r package phenopath v1.4.0
R Package Phenopath V1.4.0, supplied by PhenoPath, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/r package phenopath v1.4.0/product/PhenoPath
Average 90 stars, based on 1 article reviews
r package phenopath v1.4.0 - by Bioz Stars, 2026-06
90/100 stars
  Buy from Supplier

90
Siemens AG primer pair f actin /r actin
Primer Pair F Actin /R Actin, supplied by Siemens AG, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/primer pair f actin /r actin/product/Siemens AG
Average 90 stars, based on 1 article reviews
primer pair f actin /r actin - by Bioz Stars, 2026-06
90/100 stars
  Buy from Supplier

90
GraphPad Software Inc prism 6.02
Prism 6.02, supplied by GraphPad Software Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/prism 6.02/product/GraphPad Software Inc
Average 90 stars, based on 1 article reviews
prism 6.02 - by Bioz Stars, 2026-06
90/100 stars
  Buy from Supplier

90
Calmet Laboratory Services r. rattus
R. Rattus, supplied by Calmet Laboratory Services, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/r. rattus/product/Calmet Laboratory Services
Average 90 stars, based on 1 article reviews
r. rattus - by Bioz Stars, 2026-06
90/100 stars
  Buy from Supplier

N/A
EphA8 antibody was raised in Mouse using a purified recombinant fragment of EphA8(aa70-150) expressed in E. coli as the immunogen. Mouse monoclonal EphA8 antibody.
  Buy from Supplier

N/A
Rabbit polyclonal Zap 70 antibody
  Buy from Supplier

N/A
Rabbit polyclonal Transaldolase antibody (HRP)
  Buy from Supplier


N/A
Recombinant human CST9 protein (His tag)
  Buy from Supplier

N/A
GUK1 antibody was raised using the middle region of GUK1 corresponding to a region with amino acids IEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYI. Rabbit polyclonal GUK1 antibody raised against the middle region of GUK1.
  Buy from Supplier

N/A
The IgG2b Antibody (RM108) [Biotin] from Novus is a IgG2b antibody to IgG2b. This antibody reacts with Mouse. The IgG2b antibody has been validated for the following applications: Western Blot, ELISA.
  Buy from Supplier

Image Search Results